PowerPoint Slides, Secondary Structure - Primary Sequence | CHEM 641, Study notes of Biochemistry

Download PowerPoint Slides, Secondary Structure - Primary Sequence | CHEM 641 and more Study notes Biochemistry in PDF only on Docsity! 1 Primary sequence >gi|4504349|ref|NP_000509.1| beta globin [Homo sapiens] MVHLTPEEKSAVTALWGKVNVDEVGEALGRLLVVY PWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRL LGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAN ALAHKYH Human hemoglobin beta-subunit (FASTA format) Some powerpoint slides shown during CHEM 641 class 9/12/07 N Cα N Cα N Cα N Cα N Cα N Cα N Cα N Cα H O H O H O H O H O H O H O HO R R R R R R R R N Cα N Cα N Cα N Cα O H O H O H OH Cα O N N-term H N CαN CαN CαN Cα O HO HO H H Cα O N C-term O R R R R R R R RR R H N Cα N Cα N Cα O H O H OH Cα O N N-term H R R R R N Cα C-term OH R N Cα N Cα N Cα O H O H OH Cα O N N-term H R R R R N Cα C-term OH R α-helix anti-parallel β-sheet parallel β-sheet double headed arrows indicate hydrogen bonds Primary Sequence Secondary Structure α-helix 2 Secondary Structure Tertiary Structure Tertiary Structure Quaternary Structure ht-ADH from B. stearothermophilus is a homotetramer